Skip to product information

Tesamorelin (10mg)

Tesamorelin (10mg)

Regular price $74.99
Regular price $74.99 Sale price
SAVE Sold out
Tesamorelin (10mg)

Tesamorelin (10mg)

Regular price $74.99
Regular price $74.99 Sale price
SAVE Sold out

Tesamorelin is a synthetic peptide composed of 44 amino acids and functions as an analog of growth hormone-releasing hormone (GHRH). Through modification at the N-terminus, Tesamorelin exhibits enhanced stability compared to native GHRH, making it of particular interest for controlled laboratory investigation. Research use has focused on its ability to interact with GHRH receptors in the anterior pituitary, where it may influence the secretion of endogenous growth hormone and downstream insulin-like growth factor-1 (IGF-1) activity. Supplied in lyophilized form at ≥99% purity, Tesamorelin is intended strictly for scientific research applications.

Disclaimer: This product is for research use only. Not for human consumption, medical, or diagnostic use.

  • local_shipping Fast Shipping
  • 99% Purity
  • factory Made in USA
View full details

What is Tesamorelin?

Tesamorelin is a synthetic 44-amino acid analog of growth hormone-releasing hormone (GHRH) with enhanced stability modifications. This research compound stimulates natural growth hormone release by targeting GHRH receptors in the pituitary gland. Laboratory studies have examined tesamorelin's interactions with growth hormone pathways, IGF-1 production mechanisms, and metabolic signaling systems. Scientific investigations have documented its influence on fat metabolism, cognitive function pathways, and hormone regulation studies, making it valuable for research into growth hormone axis function and metabolic processes in experimental applications.

Chemical Structure of Tesamorelin

Sequence:YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (44 amino acids)

Molecular Formula: C₂₂₃H₃₇₀N₇₂O₆₉S

Molecular Weight: 5,196 g/mol

PubChem CID: 44147413

Structural Modification: Trans-3-hexenoic acid attached to N-terminal tyrosine for enhanced stability

Research and Clinical Studies on Tesamorelin

1. Lipodystrophy Research Models: Laboratory investigations have examined tesamorelin's interactions with abnormal fat distribution patterns, documenting 15.4% visceral adipose tissue reductions and improvements in triglyceride and cholesterol levels in controlled protocols.

2. Hepatic Fat Research Studies: Scientific investigations have explored tesamorelin's effects on hepatic fat fraction reduction, with studies showing 35% of subjects achieving HFF reductions below 5% compared to 4% in placebo groups.

3. Cognitive Function Research: Laboratory studies have investigated tesamorelin's influence on neurological functioning and cognitive performance pathways using Global Deficit Score measurements in controlled clinical environments.

4. Insulin Sensitivity Research: Scientific studies have examined tesamorelin's interactions with glucose homeostasis and diabetes control pathways, documenting effects on fasting glucose, glycosylated hemoglobin, and insulin sensitivity markers.

5. Muscle Tissue Research Applications: Experimental investigations have explored tesamorelin's effects on muscle density and composition using computed tomography protocols, documenting improvements in specific muscle groups compared to control groups.

6. Visceral Fat Research Studies: Laboratory analyses have investigated tesamorelin's mechanisms in visceral obesity reduction, documenting potential fat reductions up to 25% and interactions with metabolic pathways in experimental models.

Citations